Recombinant Full Length Gorilla Gorilla Gorilla Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged
Cat.No. : | RFL28376GF |
Product Overview : | Recombinant Full Length Gorilla gorilla gorilla Muscarinic acetylcholine receptor M3(CHRM3) Protein (Q9N2A3) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gorilla gorilla gorilla (Western lowland gorilla) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTDTHFGSYNVSRAAGNFSSPDGTTDDPL GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCGKKKRRKQQYQQRQSVIFHKRAPEQAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHRM3 |
Synonyms | CHRM3; Muscarinic acetylcholine receptor M3 |
UniProt ID | Q9N2A3 |
◆ Native Proteins | ||
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NHLH1-3833HCL | Recombinant Human NHLH1 293 Cell Lysate | +Inquiry |
MT1HL1-4098HCL | Recombinant Human MT1P2 293 Cell Lysate | +Inquiry |
TRPV6-729HCL | Recombinant Human TRPV6 293 Cell Lysate | +Inquiry |
NEIL2-3881HCL | Recombinant Human NEIL2 293 Cell Lysate | +Inquiry |
RTN4R-2585MCL | Recombinant Mouse RTN4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM3 Products
Required fields are marked with *
My Review for All CHRM3 Products
Required fields are marked with *
0
Inquiry Basket