Recombinant Full Length Photorhabdus Luminescens Subsp. Laumondii Upf0283 Membrane Protein Plu2581(Plu2581) Protein, His-Tagged
Cat.No. : | RFL5982PF |
Product Overview : | Recombinant Full Length Photorhabdus luminescens subsp. laumondii UPF0283 membrane protein plu2581(plu2581) Protein (Q7N3Y1) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Photorhabdus luminescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MTEPLKPRIDFAESLSGPQEPVLKPAQIFNEKETANFCPASPELEAEEREGQVEGIVNAA LKPKRSGWRKMVYGSLMLLGLSAVAQFVQWIYQSWQQQDWSALGVAAAGSMIVFAGIGSL VSEWHRLYRLRVRSEERDTARALLQHHGVGKGREFCEKLASQAGIEQHNPALQRWRAALH DTHNDREVVVLYSKWVQPVLDSQVRAEISRCAAESALMIAVSPLAIVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIVFSGASEVVREVGMDWLSQDIAARLSVRAAQGI GVGLLTARLGIKAMELCRPLPWIEGDKPKLGDFRRQLITQLKNILPNKSKNIVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plu2581 |
Synonyms | plu2581; UPF0283 membrane protein plu2581 |
UniProt ID | Q7N3Y1 |
◆ Recombinant Proteins | ||
Tmem222-6491M | Recombinant Mouse Tmem222 Protein, Myc/DDK-tagged | +Inquiry |
RFL17548SF | Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit C1 Protein, His-Tagged | +Inquiry |
CD47-90H | Recombinant Human CD47 protein, T7/His-tagged | +Inquiry |
RBX1-1980HFL | Recombinant Full Length Human RBX1 Protein, C-Flag-tagged | +Inquiry |
RAD9B-4570R | Recombinant Rat RAD9B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Ovary -152H | Human Fetal Ovary Lysate | +Inquiry |
Daudi-160H | Daudi Whole Cell Lysate | +Inquiry |
SULF2-1359HCL | Recombinant Human SULF2 293 Cell Lysate | +Inquiry |
HA-2331HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
SPRR4-1492HCL | Recombinant Human SPRR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All plu2581 Products
Required fields are marked with *
My Review for All plu2581 Products
Required fields are marked with *
0
Inquiry Basket