Recombinant Human CD47 protein, T7/His-tagged

• Cat.No.: CD47-90H
• Product Overview: Recombinant human CD47, which carry single Ig-like V type domain cDNA (19 – 127 aa, derived from BC012884) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRD IYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETII
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated CD47 longest extracellular domain protein mediated "don"t eat me" signal regulation study for cancer cell imgration, T cell activation et al. with this protein as either coating matrix protein or soluble factor.2. May be used as CD47 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Protein length: 19-127 a.a.

Gene Information

• Gene Name: CD47 CD47 molecule [ Homo sapiens ]
• Official Symbol: CD47
• Synonyms: CD47; CD47 molecule; CD47 antigen (Rh related antigen, integrin associated signal transducer) , MER6; leukocyte surface antigen CD47; antigen identified by monoclonal 1D8; antigenic surface determinant protein OA3; CD47 glycoprotein; IAP; integrin assoc
• Gene ID: 961
• mRNA Refseq: NM_001777
• Protein Refseq: NP_001768
• MIM: 601028
• UniProt ID: Q08722
• Chromosome Location: 3q13.1-q13.2
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem
• Function: protein binding; thrombospondin receptor activity