Recombinant Full Length Human RBX1 Protein, C-Flag-tagged

• Cat.No.: RBX1-1980HFL
• Product Overview: Recombinant Full Length Human RBX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 12.1 kDa
• AA Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Nucleotide excision repair, Oocyte meiosis, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathwa
• Full Length: Full L.

Gene Information

• Gene Name: RBX1 ring-box 1 [ Homo sapiens (human) ]
• Official Symbol: RBX1
• Synonyms: ROC1; RNF75; BA554C12.1
• Gene ID: 9978
• mRNA Refseq: NM_014248.4
• Protein Refseq: NP_055063.1
• MIM: 603814
• UniProt ID: P62877