Recombinant Full Length Alcanivorax Borkumensis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL11705AF |
Product Overview : | Recombinant Full Length Alcanivorax borkumensis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q0VQP5) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alcanivorax borkumensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MSQPIPPEDVWPTYKRLLSYVRPYWFMLVISVIGYALYAGAQAGAAQLAGYLGDTIVNPT DARVLIVSIAPLVLVLFQGLGQFMGSYSMNWVAQQIVYVLRNDVFEHVLKLPQSEYHRNA SGRIMSKIIFDAQQVTSAGTDAIIVIIREGLTVIGLFSFLLWQNWKLTLILVTVVPLIAL VMNITSKRFRKISRRIQSSMANITHFLGEAIEGSGEVKIFGGQAQEADRFHNVSRSFAKQ NVKLNASKIASTVIVQLFVAVGIGFITYLYIHLMGEDLTVGGFLSYITAAGMIQKPLKQL TDVNVKVQRGVTGAASLFELLDTEQETDTGTYTVATKVDGNIDFEGVSFGYDPASPVVRQ LNFAIKAGETVALVGRSGAGKSTISAMLPRFFDPDQGRILLDGIPLQEYQLSELRNQIAM VSQRVVLFNDSVRNNIAYGELRSSDDASIIKAAKDAHAWSFIEQLEHGLDTLLGQDGVQL SGGQRQRIAIARALLKDAPVLILDEATSALDSESEHHIQQALEQVMQGRTTLVIAHRLST IEKADRIMVLDQGQLIEQGSHQQLLEKNGLYTQMYRMNFSEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; ABO_1055; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q0VQP5 |
◆ Recombinant Proteins | ||
CSF1R-051H | Active Recombinant Human CSF1R protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
Csf2-553R | Active Recombinant Rat Csf2 protein(Ala18-Lys144), hFc-tagged | +Inquiry |
IL31RA-2933H | Recombinant Human IL31RA Protein (Val130-Asp622), N-His tagged | +Inquiry |
CRISP1-1979M | Recombinant Mouse CRISP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLGN2-3042R | Recombinant Rhesus monkey NLGN2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Testosterone-01H | Native Human Testosterone | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKN1-1363HCL | Recombinant Human PKN1 cell lysate | +Inquiry |
STK10-1711HCL | Recombinant Human STK10 cell lysate | +Inquiry |
AK2-508HCL | Recombinant Human AK2 cell lysate | +Inquiry |
HTR1B-5337HCL | Recombinant Human HTR1B 293 Cell Lysate | +Inquiry |
HSD17B14-470HCL | Recombinant Human HSD17B14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket