Recombinant Full Length Blochmannia Pennsylvanicus Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL16666BF |
Product Overview : | Recombinant Full Length Blochmannia pennsylvanicus Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q492S9) (1-584aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Blochmannia pennsylvanicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-584) |
Form : | Lyophilized powder |
AA Sequence : | MLQYNKNHSSTWQTFRRLWPIIFPFRVGLVVASITLILNATSDALMLALLKPLLDDGFGK ANRDVFVWMPLALVGLMGIRGFSGFASTYCISWVSGKVVMQMRRALFKHIMNMPVSFFVK QSTGTLVSRITYDSDQVASSSSGALVTVIREGASIIGLCIMMFYYSWQLSLILVLIAPIV SITIKLVSHRFRTISKKMQSAMGQLTSSAEQMLQGHKEVLIFGGQHTEKDRFNCVSNRMR QQSMKMVQTSSIFDPLIQCVASLALAFVLYAASIPSVMEMLTAGTITVIFSSMIVLMKPL KSLTNVSAQFQRGMAACQTLFSILDLETEKDQGILDITRVQGHIIFDDVTFFYPEKNTPS LYKINFSIESGKTVALVGRSGSGKSTIVNLLTRFYDIDKGRILLDGFNLNDYKLASLRNQ IAMVSQNVHLFNDTIANNIAYARRNFYSRESIETAARMACAMDFISQMKNGLDTIIGENG ILLSSGQRQRIAIARALLRDCPILIFDEATSALDSASEHIIHKSLDTLKKNRTSLIIAHR LSTVENADEILVIENGYIMERGVHKVLIRRQGIYAQLYKLQFSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BPEN_390; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q492S9 |
◆ Recombinant Proteins | ||
Ywhab-5820M | Recombinant Mouse Ywhab protein, His-sumostar-tagged | +Inquiry |
EGFR-338H | Active Recombinant Human EGFR Protein (Leu 25 - Ser 645), His-tagged, low endotoxin | +Inquiry |
ARL10-1921M | Recombinant Mouse ARL10 Protein | +Inquiry |
TMX3-5546H | Recombinant Human TMX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACSS2-209H | Recombinant Human ACSS2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAG-1681HCL | Recombinant Human MAG cell lysate | +Inquiry |
Temporal Lobe-505H | Human Temporal Lobe (Alzheimers Disease) Membrane Lysate | +Inquiry |
SLC25A18-1779HCL | Recombinant Human SLC25A18 293 Cell Lysate | +Inquiry |
ANKRD54-8846HCL | Recombinant Human ANKRD54 293 Cell Lysate | +Inquiry |
Diaphragm-104C | Cynomolgus monkey Diaphragm Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket