Recombinant Full Length Phosphate Regulon Sensor Protein Phor(Phor) Protein, His-Tagged
Cat.No. : | RFL16145KF |
Product Overview : | Recombinant Full Length Phosphate regulon sensor protein phoR(phoR) Protein (P45608) (1-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-431) |
Form : | Lyophilized powder |
AA Sequence : | MLERLSWKRLALELFLACIPALILGAFVGHLPWFLLAAVTGLLIWHFWNLMRLSWWLWVD RSMTPPPGRGSWEPLLYGLHQMQMRNKKRRRELGSLIKRFRSGAESLPDAVVLTTEEGAI FWCNGLAQQILNLRWPDDSGQNILNLLRYPEFANYLKQRDFSKPLNLVLNNARHLEIRVM PYTDKQWLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMQEQVLEGATRE KALHTMREQTQRMEGLVKQLLTLSRIEAAPALAMNDRIDVPMMLRVVEREAQTLSQEKQT LIFTVDEQLKVLGNEEQLRSAISNLVYNAVNHTPPGTEIRVSWQRTPQGALFSVEDNGPG IAPEHIPLLTERFYRGDKARSRQTGGSGLGLAIVKHAVNHHDSRLEIDSTVGKGTRFSFL LPERLIARNDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoR |
Synonyms | phoR; Phosphate regulon sensor protein PhoR |
UniProt ID | P45608 |
◆ Recombinant Proteins | ||
NRM-3741R | Recombinant Rat NRM Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN3-6980H | Recombinant Human CDKN3, GST-tagged | +Inquiry |
YBDO-3850B | Recombinant Bacillus subtilis YBDO protein, His-tagged | +Inquiry |
RETN-761H | Recombinant Human RETN | +Inquiry |
YWHAH-1764C | Recombinant Chicken YWHAH | +Inquiry |
◆ Native Proteins | ||
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBFC2B-3610HCL | Recombinant Human OBFC2B 293 Cell Lysate | +Inquiry |
LYPD6B-397HCL | Recombinant Human LYPD6B lysate | +Inquiry |
SV2A-1329HCL | Recombinant Human SV2A 293 Cell Lysate | +Inquiry |
IER2-5298HCL | Recombinant Human IER2 293 Cell Lysate | +Inquiry |
FGFR4-2757MCL | Recombinant Mouse FGFR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoR Products
Required fields are marked with *
My Review for All phoR Products
Required fields are marked with *
0
Inquiry Basket