Recombinant Full Length Escherichia Coli Phosphate Regulon Sensor Protein Phor(Phor) Protein, His-Tagged
Cat.No. : | RFL4918EF |
Product Overview : | Recombinant Full Length Escherichia coli Phosphate regulon sensor protein phoR(phoR) Protein (P08400) (1-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-431) |
Form : | Lyophilized powder |
AA Sequence : | MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIWHFWNLLRLSWWLWVD RSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGGI FWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSRPLNLVLNTGRHLEIRVM PYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMNEQPLEGAVRE KALHTMREQTQRMEGLVKQLLTLSKIEAAPTHLLNEKVDVPMMLRVVEREAQTLSQKKQT FTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRVPHGAEFSVEDNGPG IAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGKGTRFSFV IPERLIAKNSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoR |
Synonyms | phoR; nmpB; b0400; JW0390; Phosphate regulon sensor protein PhoR |
UniProt ID | P08400 |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
Adrenal-019H | Human Adrenal Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf65-8310HCL | Recombinant Human C12orf65 293 Cell Lysate | +Inquiry |
MNX1-4268HCL | Recombinant Human MNX1 293 Cell Lysate | +Inquiry |
SQRDL-1482HCL | Recombinant Human SQRDL 293 Cell Lysate | +Inquiry |
UBE2J1-572HCL | Recombinant Human UBE2J1 293 Cell Lysate | +Inquiry |
Eye-537E | Equine Eye Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoR Products
Required fields are marked with *
My Review for All phoR Products
Required fields are marked with *
0
Inquiry Basket