Recombinant Full Length Pseudomonas Aeruginosa Phosphate Regulon Sensor Protein Phor(Phor) Protein, His-Tagged
Cat.No. : | RFL19096PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Phosphate regulon sensor protein phoR(phoR) Protein (P23621) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MQSVVNQDWRGALIRHLLLVLAASLVLGVVSGHYGWALALGLALYLGWTLWQLLRLHQWL RNHQPDEPPPDSYGLWGEVFDNIYHLQRRNQRARGRLQAVIDRIQESTAALRDAVIMLDS DGNLEWWNLAAENLLGLKTPQDGGQPVSNLIRHPRFKEYFDQEDYREPLEIPSPINERLR LQFHITLYGNREHLMLVRDVTRVHQLEQMRKDFVANVSHELRTPLTVIAGYLETLLDNVE DVNPRWLRALQQMQQQAGRMQNLLNDLLLLAKLEATDYPGDNKPVAVDALLASIRNDAQA LSAGRNHRISLDAAPAVQLKGSEAELRSAFSNLVFNAVKYTPDEGEIRIRWWADEQGAHL SVQDTGIGVDPKHLPRLTERFYRVDSSRASNTGGTGLGLAIVKHVLIRHRARLEISSVPG KGSTFTCHFAPAQVAEAERKAPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoR |
Synonyms | phoR; PA5361; Phosphate regulon sensor protein PhoR |
UniProt ID | P23621 |
◆ Recombinant Proteins | ||
HA-1888H | Recombinant H3N2 (A/Sydney/5/97) HA (ΔTM) Protein, His-tagged | +Inquiry |
IL6RA-3322H | Active Recombinant Human IL6RA protein | +Inquiry |
RFL32751BF | Recombinant Full Length Bovine Transmembrane Protein C9Orf91 Homolog Protein, His-Tagged | +Inquiry |
SULT2A1-3088H | Recombinant Human SULT2A1 protein, His-tagged | +Inquiry |
UBE2G2-0038H | Recombinant Human UBE2G2 Protein (A2-L165), Tag Free | +Inquiry |
◆ Native Proteins | ||
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
VTN-3H | Native Human multimeric vitronectin, Biotin labeled | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD3B1-5370HCL | Recombinant Human HSD3B1 293 Cell Lysate | +Inquiry |
MAGEB10-4547HCL | Recombinant Human MAGEB10 293 Cell Lysate | +Inquiry |
METTL20-8308HCL | Recombinant Human C12orf72 293 Cell Lysate | +Inquiry |
ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
KLHDC3-4921HCL | Recombinant Human KLHDC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoR Products
Required fields are marked with *
My Review for All phoR Products
Required fields are marked with *
0
Inquiry Basket