Recombinant Full Length Haemophilus Influenzae Phosphate Regulon Sensor Protein Phor(Phor) Protein, His-Tagged
Cat.No. : | RFL9290HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Phosphate regulon sensor protein phoR(phoR) Protein (P71380) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MKKILNFIVEINLAIIISLFTSDFILWFAIILLLILAWHHINEYRLLKYLNLKQDNKFSL LQLGTFSQTEAYHRHQIYKEKCASLRLLSQINKNIKYLPDAIIICQHNGNISWCNSIAPQ MFDFCWDKKVQENIFDVIFYEQFKHYFFSPKKRRPLVLLTYNQRYIEVQSHAYNSHMILV IARDITDMIHLLNSRQKFLSNINHELRTPLTVLQGYLEILADNNIQNPLQKKAIXAMQEQ SQRMEHLLQQFNFLAKIETTSDKDFRKFDMSAMINSLRKDTDILNTYNHHIEFIIQPNII IFGNESQLRSAVSNLIYNAIKHSGKQCHIQIQWETCEQGIKFNVIDNGVGISPQHIPHLT ERFYRVDESRSHLTGGSGLGLAIVKHTLLQYHSHLNIESTETKGSSFSFIIPKRFVISKN NKEIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoR |
Synonyms | phoR; HI_1378; Phosphate regulon sensor protein PhoR |
UniProt ID | P71380 |
◆ Native Proteins | ||
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
FAM70A-6358HCL | Recombinant Human FAM70A 293 Cell Lysate | +Inquiry |
DEPDC1-6974HCL | Recombinant Human DEPDC1 293 Cell Lysate | +Inquiry |
FUT8-001HCL | Recombinant Hamster FUT8 cell lysate | +Inquiry |
POU5F1-3000HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoR Products
Required fields are marked with *
My Review for All phoR Products
Required fields are marked with *
0
Inquiry Basket