Recombinant Full Length Coccidioides Posadasii Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL33814CF |
Product Overview : | Recombinant Full Length Coccidioides posadasii Formation of crista junctions protein 1(FCJ1) Protein (C5P436) (12-671aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coccidioides posadasii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (12-671) |
Form : | Lyophilized powder |
AA Sequence : | LLSPTTGRQWLQSSRVRGGLVGKKHYSRTRKAPVISKAIPTLDGVVLPVRGNNAFTTSAI LANDSHVRSPPSPSSESAIAPEGVPRPPQSHPVQTSPGSSVDGRAQPPPETNTPPPPPPP APKKGGRFRRFLIYLIFTTGLAYAGGIWLSLTSDNFHDFFTEYVPYGEEAVLYVEEQDFR RRFPNAARQITRRVTGPREEGQNVTIPGKSGLSWKVSEEESEAKEAGSDVSRKGKHMSAT EVNKEKTAAVEQVKAKKEAAPAIKKETTPAESKKPALEEARSPALPTASPVQPLSIAIED EPTVQELMRIVNDLISVVNADESSSRFTSTLSKAKADFEKLGERIIAAKQESYKFAQEEI EKARADMEKSANELIRRIDEVRADDAAQFREEYEAERERLARAYQEKIKIELQRVQEVSE QRLRNELVEQAIELNRKFLSDVRSLVENEREGRLSKLSELTANVGELERLTAEWNSVVDT NLTTQQLQVAVDAVRSALENSDIPRPFINELVAVKELAAGDPVVDAAISSISPVAYQRGI PSSAQIIERFRRLATEVRKASLLPENAGIASHAASYMMSKVMFKKQGSEEGDDVESILTR TETLLEEGRLDDAAREMNSLQGWSKILSKDWLADVRRVLEVNQALELIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; CPC735_063270; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C5P436 |
◆ Recombinant Proteins | ||
IRBP-9019Z | Recombinant Zebrafish IRBP | +Inquiry |
MEF2B-8329Z | Recombinant Zebrafish MEF2B | +Inquiry |
SUCC-3802S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SUCC protein, His-tagged | +Inquiry |
KRTAP4-8-3300H | Recombinant Human KRTAP4-8 Protein, His (Fc)-Avi-tagged | +Inquiry |
SEPT7-1931C | Recombinant Chicken SEPT7 | +Inquiry |
◆ Native Proteins | ||
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
LDL-333H | Native Human LDL Protein | +Inquiry |
ADVag-281V | Active Native ADV Protein | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRBK2-13HCL | Recombinant Human ADRBK2 lysate | +Inquiry |
PPP1R16B-2942HCL | Recombinant Human PPP1R16B 293 Cell Lysate | +Inquiry |
ZNF488-65HCL | Recombinant Human ZNF488 293 Cell Lysate | +Inquiry |
PIAS2-3203HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
AHR-8962HCL | Recombinant Human AHR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket