Recombinant Full Length Pasteurella Multocida Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL34458PF |
Product Overview : | Recombinant Full Length Pasteurella multocida Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q9CMG7) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pasteurella multocida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MQDKDLSTVQTFKRLWPIISPFKLGLVVSGIALVINALADAGLISLLKPLLDEGFGKADV SFLRTMSYVVVLVIFLRGISNFISSYCLSWVSGKVVMIMRRRIFKHLMFMPVPFFDQNSS GRLLSRITYDSELVANSSSGALITIVREGAYIISLLAVMLYTSWQLSIVLFLIGPIIAVL IRFVSKRFRELSKNMQNSMGELTSTAEQMLKGHKVVLSFGGQIVEEERFNHVSNDMRRKG MKMAVADAISNPVVQIIASFALAAVLYLATVPTIMDQNLTAGSFTVVFSSMLAMMRPLKS LTNVNAQFQKGMAACQTLFALLDLETEKDLGTHKGENVQGYLSFKNVTFTYQSRDEPALR NLSFDVEKGKTVALVGRSGSGKSTIANLVTRFYDVDQGEITLDGINIQDYRLSSLRKNCA VVSQQVHLFNDTIANNIAYAAKDKYSREEIIKAAKDAYAMEFIEKLEHGLDTVIGENGVN LSGGQRQRLAIARALLRNSPVLILDEATSALDTESERSIQLALEKLQKERTVIVIAHRLS TIENADEILVIEHGEIKERGSHSELLALNGAYKQLHHIQVNH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PM0861; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q9CMG7 |
◆ Recombinant Proteins | ||
RFL31689EF | Recombinant Full Length Nitrate/Nitrite Sensor Protein Narx(Narx) Protein, His-Tagged | +Inquiry |
FLOT2-1555HFL | Recombinant Full Length Human FLOT2 Protein, C-Flag-tagged | +Inquiry |
VWA1-7810H | Recombinant Human VWA1 protein, His & T7-tagged | +Inquiry |
FAM3A-1432R | Recombinant Rhesus Macaque FAM3A Protein, His (Fc)-Avi-tagged | +Inquiry |
FGFR1-138HF | Recombinant Human FGFR1 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
Avidin-155C | Active Native Chicken Egg White Avidin | +Inquiry |
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-Pylorus-503H | Human Stomach-Pylorus Membrane Lysate | +Inquiry |
KLHL10-941HCL | Recombinant Human KLHL10 cell lysate | +Inquiry |
PIAS2-3203HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
AKR1C2-8930HCL | Recombinant Human AKR1C2 293 Cell Lysate | +Inquiry |
HNRNPA1L2-5451HCL | Recombinant Human HNRNPA1L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket