Recombinant Full Length Pan Troglodytes Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged
Cat.No. : | RFL36686PF |
Product Overview : | Recombinant Full Length Pan troglodytes Muscarinic acetylcholine receptor M3(CHRM3) Protein (Q9N2A4) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MTLHSNSTTSSLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQZRQSVIFHKRAPEQAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHRM3 |
Synonyms | CHRM3; Muscarinic acetylcholine receptor M3 |
UniProt ID | Q9N2A4 |
◆ Recombinant Proteins | ||
YBAR-1814B | Recombinant Bacillus subtilis YBAR protein, His-tagged | +Inquiry |
CD86-584H | Active Recombinant Human CD86, Fc-tagged, Biotinylated | +Inquiry |
CHD1-6842Z | Recombinant Zebrafish CHD1 | +Inquiry |
ACADSB-240M | Recombinant Mouse ACADSB Protein, His (Fc)-Avi-tagged | +Inquiry |
HAPLN4-4057M | Recombinant Mouse HAPLN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgM-210R | Native Rabbit IgM | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB1-810HCL | Recombinant Human HOXB1 cell lysate | +Inquiry |
BNIPL-8421HCL | Recombinant Human BNIPL 293 Cell Lysate | +Inquiry |
TBCK-1088HCL | Recombinant Human TBCK cell lysate | +Inquiry |
C1orf50-8157HCL | Recombinant Human C1orf50 293 Cell Lysate | +Inquiry |
LYZ-4580HCL | Recombinant Human LYZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM3 Products
Required fields are marked with *
My Review for All CHRM3 Products
Required fields are marked with *
0
Inquiry Basket