Recombinant Full Length Rat Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged
Cat.No. : | RFL18528RF |
Product Overview : | Recombinant Full Length Rat Muscarinic acetylcholine receptor M3(Chrm3) Protein (P08483) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Chrm3 |
Synonyms | Chrm3; Chrm-3; Muscarinic acetylcholine receptor M3 |
UniProt ID | P08483 |
◆ Recombinant Proteins | ||
SPATA2-4239R | Recombinant Rhesus Macaque SPATA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPDC1-6021H | Recombinant Human NPDC1 Protein, GST-tagged | +Inquiry |
MSS51-3797R | Recombinant Rat MSS51 Protein | +Inquiry |
PTSI-0267B | Recombinant Bacillus subtilis PTSI protein, His-tagged | +Inquiry |
RFL26953BF | Recombinant Full Length Bacillus Pumilus Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
Lectin-1721P | Native Peanut Lectin | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
CES2-2139HCL | Recombinant Human CES2 cell lysate | +Inquiry |
METAP2-457MCL | Recombinant Mouse METAP2 cell lysate | +Inquiry |
DLGAP4-484HCL | Recombinant Human DLGAP4 cell lysate | +Inquiry |
TALDO1-1257HCL | Recombinant Human TALDO1 293 Cell Lysate | +Inquiry |
RPL32-2205HCL | Recombinant Human RPL32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Chrm3 Products
Required fields are marked with *
My Review for All Chrm3 Products
Required fields are marked with *
0
Inquiry Basket