Recombinant Full Length Bovine Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged
Cat.No. : | RFL9346BF |
Product Overview : | Recombinant Full Length Bovine Muscarinic acetylcholine receptor M3(CHRM3) Protein (P41984) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MTLHNNNTTSPLFPNISSSWIHGPSDTGLPPGTVTHFGSYNISRAAGNLSSPNGTTSDPL GGHTIWQVVFIAFLTGVLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSM KRSARRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGSVGLERKPSKLQTQQSMDDGGSF QKSFSKLPIQLESAVDTAKASDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN PVCYALCNKTFRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHRM3 |
Synonyms | CHRM3; Muscarinic acetylcholine receptor M3 |
UniProt ID | P41984 |
◆ Recombinant Proteins | ||
RABEPK-426Z | Recombinant Zebrafish RABEPK | +Inquiry |
CASP9-49H | Active Recombinant Human CASP9 protein | +Inquiry |
NI36-RS09255-1121S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS09255 protein, His-tagged | +Inquiry |
TNFSF4-84M | Recombinant Mouse TNFSF4 Protein, His-tagged | +Inquiry |
ECI2-923H | Recombinant Human ECI2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C3b-06M | Native Mouse C3b Protein | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
Collagen Type I & III-07P | Native Porcine Collagen Type I and III Protein | +Inquiry |
VTN -51P | Native Porcine multimeric vitronectin | +Inquiry |
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZGPAT-169HCL | Recombinant Human ZGPAT 293 Cell Lysate | +Inquiry |
SYT6-647HCL | Recombinant Human SYT6 lysate | +Inquiry |
ADRA2A-9000HCL | Recombinant Human ADRA2A 293 Cell Lysate | +Inquiry |
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
CLIC1-7448HCL | Recombinant Human CLIC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM3 Products
Required fields are marked with *
My Review for All CHRM3 Products
Required fields are marked with *
0
Inquiry Basket