Recombinant Full Length Osmolarity Sensor Protein Envz(Envz) Protein, His-Tagged
Cat.No. : | RFL11343SF |
Product Overview : | Recombinant Full Length Osmolarity sensor protein EnvZ(envZ) Protein (P0AEJ5) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML ELGTSERGGLSIRAWLPVPVTRAQGTTKEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | envZ |
Synonyms | envZ; SF3423; S4340; Sensor histidine kinase EnvZ; Osmolarity sensor protein EnzV |
UniProt ID | P0AEJ5 |
◆ Native Proteins | ||
Collagen-326H | Native Human Collagen Type III | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adipose-6H | Human Adipose Subcutaneous Diabetic Disease Lysate | +Inquiry |
STAP1-1425HCL | Recombinant Human STAP1 293 Cell Lysate | +Inquiry |
TUBGCP4-1862HCL | Recombinant Human TUBGCP4 cell lysate | +Inquiry |
SERPINB6B-501MCL | Recombinant Mouse SERPINB6B cell lysate | +Inquiry |
RPL15-2222HCL | Recombinant Human RPL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All envZ Products
Required fields are marked with *
My Review for All envZ Products
Required fields are marked with *
0
Inquiry Basket