Recombinant Full Length Arabidopsis Thaliana Probable S-Acyltransferase At5G05070(At5G05070) Protein, His-Tagged
Cat.No. : | RFL36514AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable S-acyltransferase At5g05070(At5g05070) Protein (Q5PNZ1) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MQRERMSKKKISQVHCIPSGDHILMTASSSKHIPHIRFYKAWKGNNRFCCGGRLIFGPDV SSLYLTSFLIGAPALTFCIRMLVWIKRGDPFFNYTVLASGFILTLLDFTFLMLTSARDPG IIPRNKTSMILEDDSDSSLTQSMEWVNNKTPNLKIPRTKDVFVNGYTIKVKFCDTCLLYR PPRASHCSICNNCVQRFDHHCPWVGQCIARRNYPFFICFISSSTLLCIYVFVFSWINLIR QPGKLWRTMSDDIVSVILIVYTFVAVWFVGGLTIFHFYLMSTNQTTYENFRYRYDKKENP YKRGLLKNVKEVLFAKIPPSQLDLRAMVPEEDDMTIASNDSEYESEYTSSVRYDTEMGGK LIKRDSPRKLPLPTRNLDDIKDISDNYDRSTTTREDASDRDPSFFSSQLDLPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT03 |
Synonyms | PAT03; At5g05070; MUG13.7; Probable protein S-acyltransferase 3; Probable palmitoyltransferase At5g05070; Zinc finger DHHC domain-containing protein At5g05070 |
UniProt ID | Q5PNZ1 |
◆ Recombinant Proteins | ||
RFL2310EF | Recombinant Full Length Escherichia Coli Disulfide Bond Formation Protein B(Dsbb) Protein, His-Tagged | +Inquiry |
Fbn1-2630R | Recombinant Rat Fbn1 protein, His-tagged | +Inquiry |
IGFBP3-3732C | Recombinant Chicken IGFBP3 | +Inquiry |
GYG1-2419R | Recombinant Rat GYG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSU72-16048M | Recombinant Mouse SSU72 Protein | +Inquiry |
◆ Native Proteins | ||
LRP1-87H | Native Human Lipoproteins | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
CNTF-26839TH | Native Human CNTF | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart Atrium-200H | Human Heart Atrium (LT) (Arrhythmia, infarct) Lysate | +Inquiry |
TBPL2-1208HCL | Recombinant Human TBPL2 293 Cell Lysate | +Inquiry |
CREM-7283HCL | Recombinant Human CREM 293 Cell Lysate | +Inquiry |
DERL3-224HCL | Recombinant Human DERL3 lysate | +Inquiry |
PADI4-630HCL | Recombinant Human PADI4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT03 Products
Required fields are marked with *
My Review for All PAT03 Products
Required fields are marked with *
0
Inquiry Basket