Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL24312NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P12555) (1-616aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-616) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLVFRIAILLLTVVTLAISAAALAYSMEASTPSDLVGIP TAISRTEEKITSALGSNQDVVDRIYKQVALESPLALLNTESTIMNAITSLSYQINGAANS SGCGAPIHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDRSHSHQYLALGVLRTSATGRVFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSAIPTSMVHGRLGFDGQYHEKDLDVTTLFEDWVANYP GVGGGSFIDNRVWFPVYGGLKPNSPSDTAQEGKYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRVQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRVLTVGTSHFFYQRGSSY FSPALLYPMTVSNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDPYPLVFYR NHTLRGVFGTMLDDEQARLNPVSAVFDSISRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKDDGVREARSGRLSQLQEGWKDDIVSPIFCDAKN QTEYRRELESYAASWP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12555 |
◆ Recombinant Proteins | ||
Pnck-4961M | Recombinant Mouse Pnck Protein, Myc/DDK-tagged | +Inquiry |
GARNL3-3817H | Recombinant Human GARNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANKRD28-545M | Recombinant Mouse ANKRD28 Protein, His (Fc)-Avi-tagged | +Inquiry |
Amph-403M | Recombinant Mouse Amph Protein, His-tagged | +Inquiry |
GNAT3-4643C | Recombinant Chicken GNAT3 | +Inquiry |
◆ Native Proteins | ||
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC10-8871HCL | Recombinant Human ANAPC10 293 Cell Lysate | +Inquiry |
FOXQ1-6144HCL | Recombinant Human FOXQ1 293 Cell Lysate | +Inquiry |
TRPV6-729HCL | Recombinant Human TRPV6 293 Cell Lysate | +Inquiry |
LHX4-4749HCL | Recombinant Human LHX4 293 Cell Lysate | +Inquiry |
GDF3-5969HCL | Recombinant Human GDF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket