Recombinant Full Length Sendai Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL5800SF |
Product Overview : | Recombinant Full Length Sendai virus Hemagglutinin-neuraminidase(HN) Protein (Q783Y1) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sendai virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MDGDRSKRDSYWSTSPGGSTTKLVSDSERSGKVDTWLLILAFTQWALSIATVIICIVIAA RQGYSMERYSMTVEALNTSNKEVKESLTSLIRQEVITRAVNIQSSVQTGIPVLLNKNSRD VIQLIEKSCNRQELTQLCDSTIAVHHAEGIAPLEPHSFWRCPAGEPYLSSDPEVSLLPGP SLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMFPD LNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDILDLKGR TKSHRYSNSEIDLDHPFSALYPSVGSGIATEGSLIFLGYGGLTTPLQGDTKCRIQGCQQV SQDTCNEALKITWLGGKQVVSVLIQVNDYLSERPRIRVTTVPITQNYLGAEGRLLKLGDQ VYIYTRSSGWHSQLQIGVLDVSHPLTISWTPHEALSRPGNEDCNWYNTCPKECISGVYTD AYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVKLEAAYTTTSCITHFG KGYCFHIIEINQKSLNTLQPMLFKTSIPKLCKAES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase; HN protein |
UniProt ID | Q783Y1 |
◆ Native Proteins | ||
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
Brain-824M | Mini pig Brain Membrane Lysate, Total Protein | +Inquiry |
GPATCH8-5816HCL | Recombinant Human GPATCH8 293 Cell Lysate | +Inquiry |
MAT2B-4452HCL | Recombinant Human MAT2B 293 Cell Lysate | +Inquiry |
LRRTM4-2230HCL | Recombinant Human LRRTM4 cell lysate | +Inquiry |
CABP7-7907HCL | Recombinant Human CABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket