Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL20751NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P12553) (1-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-577) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLIFRIAILLLTVVTLATSVASLVYSMGASTPSDLVGIP TRISRAEEKITSALGSNQDVVDRIYKQVALESPLALLNTETTIMNAITSLSYQINGAANN SGWGAPIHDPDFIGGIGKELIVDDASDVTSFYPSAFQEHHNFIPAPTTGSGCIRIPSFDM SATHYCYTHNIISSGCRDHSHSYQYLALGVLRTSATGRIFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSAVPTLMVHGRLGFDGQYHEKDLDVTTLFEDWVANYP GVGGGSFIDSRVWFSVYGGLKPNSPSDTVQEEKYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSY FSPALLYPMTVSNKTATLHSPYTFNAFTRPGSIPCQASARCPNSCVTGVYTDPYPLIFYR NHTLRGVFGTMLDGEQARLNPASAVFDSTSRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKNDGVREARSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12553 |
◆ Recombinant Proteins | ||
COAE-2381E | Recombinant Escherichia coli COAE Protein (1-206 aa), His-SUMO-Myc-tagged | +Inquiry |
TMEM55B-775C | Recombinant Cynomolgus Monkey TMEM55B Protein, His (Fc)-Avi-tagged | +Inquiry |
Homer2-3426M | Recombinant Mouse Homer2 Protein, Myc/DDK-tagged | +Inquiry |
ARID4A-797H | Recombinant Human ARID4A protein, GST-tagged | +Inquiry |
FMOD-912H | Recombinant Human FMOD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
HB-40C | Native Cattle Hemoglobin (HB) Protein | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC73-7992HCL | Recombinant Human C6orf154 293 Cell Lysate | +Inquiry |
FAM190A-6394HCL | Recombinant Human FAM190A 293 Cell Lysate | +Inquiry |
SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
VPS28-393HCL | Recombinant Human VPS28 293 Cell Lysate | +Inquiry |
RIOK1-001HCL | Recombinant Human RIOK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket