Recombinant Full Length Simian Virus 5 Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL1255PF |
Product Overview : | Recombinant Full Length Simian virus 5 Hemagglutinin-neuraminidase(HN) Protein (P28885) (1-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Parainfluenza virus 5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-565) |
Form : | Lyophilized powder |
AA Sequence : | MVAEDAPVRGTCRVLFRTTTLLFLCTLLSLSISILYESLITQNQIMSQAGSTGSNSGLGS ITDLLNNILSVANQIIYNSAVALPLQLDTLESTLLTAFKSLQTSDKLEQNCSWGAALIND NRYINGINQFYFSIAEGRNLTLGPLLNILSFIPTATTPEGCTRIPSFSLTKTHWCYTHNV ILNGCQDHVSSNQFVSMGIIEPTSAGFPSFRTLKTLYLSDGVNRKSCSISTVPGGCMMYC FVSTQPERDDYFSAAPPEQRIIIMYYNDTIVERIINPPGVLDVWATLNPGTGSGVYYLGW VLFPIYGGVIKDTSLWNSQANKYFIPQMVAALCSQNQATQVQNAKSSYYSSWFGNRMIQS GILACPLQQDLTNECLVLPFSNDQVLMGAEGRLYMYGDSVYYYQRSNSWWPMTMLYKVTI TFTNGQPSAISAQNVPTQQVPRPGTGDCSATNRCPGFCLTGVYADAWLLTNPSSTSTFGS EATFTGSYLNTATQRINPTMYIANNTQIISSQQFGSSGQEAAYGHTTCFRDTGSVMVYCI YIIELSSSLLGQFQIVPFIRQVTLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P28885 |
◆ Native Proteins | ||
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
◆ Cell & Tissue Lysates | ||
OR12D3-3566HCL | Recombinant Human OR12D3 293 Cell Lysate | +Inquiry |
EML1-6609HCL | Recombinant Human EML1 293 Cell Lysate | +Inquiry |
LAIR2-1774HCL | Recombinant Human LAIR2 cell lysate | +Inquiry |
KPNA5-4888HCL | Recombinant Human KPNA5 293 Cell Lysate | +Inquiry |
ARNTL-8689HCL | Recombinant Human ARNTL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket