Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL35810NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P32884) (1-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-577) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLIFRIAILLLTVVTLATSVASLVYSMGASTPSDLVGIP TRISRAEEKITSALGSNQDVVDRIYKQVALESPLALLNTETTIMNAITSLSYQINGAANN SGWGAPIHDPDFIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDHSHSHQYLALGVLRTTATGRIFFSTLRSISLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSAVPTLMAHGRLGFDGQYHEKDLDVTTLFEDWVANYP GVGGGSFIDGRVWFSVYGGLKPNSPSDTVQEGKYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSY FSPALLYPMTVSNKTATLHSPYTFNAFTRPGSIPCQASARCPNSCVTGVYTDPYPLIFYR NHTLRGVFGTMLDSEQARLNPTSAVFDSTSRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKNDGVREARSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P32884 |
◆ Recombinant Proteins | ||
CRISP2-2213H | Recombinant Human CRISP2 Protein (Lys22-Asn240), N-His tagged | +Inquiry |
RC0497-4716R | Recombinant Rickettsia conorii RC0497 protein, His-SUMO-tagged | +Inquiry |
MME-2610R | Recombinant Rhesus Macaque MME Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL5-16H | Recombinant Human CXCL5 Protein, Biotin-tagged | +Inquiry |
CDH-1-3812S | Recombinant Sporotrichum pruinosum CDH-1 protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
Pzp-3279H | Native Human Pzp | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD4-1926HCL | Recombinant Human SETD4 293 Cell Lysate | +Inquiry |
AJUBA-5097HCL | Recombinant Human JUB 293 Cell Lysate | +Inquiry |
MCAM-2742HCL | Recombinant Human MCAM cell lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
Colon descending-101H | Human Descending Colon Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket