Recombinant Full Length Sendai Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL21842SF |
Product Overview : | Recombinant Full Length Sendai virus Hemagglutinin-neuraminidase(HN) Protein (P03425) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sendai virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MDGDRGKRDSYWSTSPSGSTTKLASGWERSSKVDTWLLILSFTQWALSIATVIICIIISA RQGYSTKEYSMTVEALNMSSREVKESLTSLIRQEVIARAVNIQSSVQTGIPVLLNKNSRD VIQMIDKSCSRQELTQLCESTIAVHHAEGIAPLEPHSFWRCPVGEPYLSSDPKISLLLGP SLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMFPD LNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDVLDLKGS TKSHRYRNSEVDLDHPFSALYPSVGNGIATEGSLIFLGYGGLTTPLQGDTKCRTQGCQQV SQDTCNEALKITWLGGKQVVNVIIRVNDYLSERPKIRVTTIPITQNYLGAEGRLLKLGDR VYIYTRSSGWHSQLQIGVLDVSHPLTINWTPHEALSRPGNKECNWYNTCPKECISGVYTD AYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVQLEVAYTTISSCITHF GKGYCFHIIEINQKSLNTLQPMLFKTSIPKLCKAES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase; HN protein |
UniProt ID | P03425 |
◆ Recombinant Proteins | ||
SECE-2729S | Recombinant Staphylococcus epidermidis ATCC 12228 SECE protein, His-tagged | +Inquiry |
EEF1A1-1207R | Recombinant Rhesus Macaque EEF1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NRAS-6750HF | Recombinant Full Length Human NRAS Protein, GST tagged | +Inquiry |
POMT2-13121M | Recombinant Mouse POMT2 Protein | +Inquiry |
LGR5-0348C | Active Recombinant Cynomolgus LGR5 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
KIAA0494-4975HCL | Recombinant Human KIAA0494 293 Cell Lysate | +Inquiry |
ATF7IP-8628HCL | Recombinant Human ATF7IP 293 Cell Lysate | +Inquiry |
NDEL1-3937HCL | Recombinant Human NDEL1 293 Cell Lysate | +Inquiry |
PLA1A-1366HCL | Recombinant Human PLA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket