Recombinant Full Length Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL10714AF |
Product Overview : | Recombinant Full Length NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q70XV9) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amborella trichopoda |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQAINSFSRLESSKEVYGLIWLFIPIFTPVSGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQAIADGTKLLFKEDLLPSRGDIRLFSIGPSVVVISILLSHLVIPFGY RLVLADLSIGVSLWIAISSIAPIGLLMSGYASNNKYSFSGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQYKYGFWGWNLWRQPIGFLAFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYLASYLNLLVSSLFVTVLYLGGWNLSIPYIAIPELFRINRIGGV FGTTISIFFTLAKAYLFLFIPITTRWTLPRMRMDQLLNLGWKFLLPIALGNLLLTTSSQL FSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q70XV9 |
◆ Recombinant Proteins | ||
ICA1-3060H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
SSP-RS05430-0540S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS05430 protein, His-tagged | +Inquiry |
PNTx4-5666C | Recombinant Ctenus nigriventer PNTx4 protein, His-tagged | +Inquiry |
ppiA-4242E | Recombinant Escherichia coli O6:H1 ppiA protein, His-SUMO & Myc-tagged | +Inquiry |
IP6K2-2741R | Recombinant Rat IP6K2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Plg-32M | Native Mouse Plg protein | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
CA9-2189MCL | Recombinant Mouse CA9 cell lysate | +Inquiry |
PIK3C2A-3191HCL | Recombinant Human PIK3C2A 293 Cell Lysate | +Inquiry |
C19orf48-8205HCL | Recombinant Human C19orf48 293 Cell Lysate | +Inquiry |
RNF151-2291HCL | Recombinant Human RNF151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket