Recombinant Human ICA1 protein, His-tagged

• Cat.No.: ICA1-3060H
• Product Overview: Recombinant Human ICA1 protein(Q05084)(1-268aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-268aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.5 kDa
• AA Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ]
• Official Symbol: ICA1
• Synonyms: ICA1; islet cell autoantigen 1, 69kDa; islet cell autoantigen 1 (69kD); islet cell autoantigen 1; ICAp69; p69; islet cell autoantigen p69; 69 kDa islet cell autoantigen; islet cell autoantigen 1 isoform; diabetes mellitus type I autoantigen; ICA69
• Gene ID: 3382
• mRNA Refseq: NM_001136020
• Protein Refseq: NP_001129492
• MIM: 147625
• UniProt ID: Q05084