Recombinant Escherichia coli O6:H1 ppiA protein, His-SUMO & Myc-tagged
Cat.No. : | ppiA-4242E |
Product Overview : | Recombinant Escherichia coli O6:H1 ppiA protein(P0AFL4)(25-190aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 25-190aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
PPIA-5692R | Recombinant Rhesus monkey PPIA protein, His-tagged | +Inquiry |
PPIA-3543R | Recombinant Rhesus monkey PPIA Protein, His-tagged | +Inquiry |
PPIA-5220H | Recombinant Human PPIA protein, His-tagged | +Inquiry |
PPIA-0216H | Recombinant Human PPIA Protein (M1-E165), Tag Free | +Inquiry |
PPIA-2096E | Recombinant Escherichia coli O157:H7 PPIA Protein (25-190 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ppiA Products
Required fields are marked with *
My Review for All ppiA Products
Required fields are marked with *
0
Inquiry Basket