Recombinant Full Length Mycobacterium Leprae Upf0353 Protein Mlbr01808 (Mlbr01808) Protein, His-Tagged
Cat.No. : | RFL3562MF |
Product Overview : | Recombinant Full Length Mycobacterium leprae UPF0353 protein MLBr01808 (MLBr01808) Protein (B8ZS82) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MTLPLLGPMSLSGFEHSWFFLFIFIVFGLAAFYVMMQVARQRRMLRFANMELLESVAPNR PVQWRHVPAILLMLALLLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMA AAQEAAKQFAGELTPGINLGLIAYAGTATVLVSPTTNRYATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGEMPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTVYGFVEINGQRQPVPVDDETMKKVAQLSGGNSYNAATLAELKAVYASLQQQIGY ETIKGDASAGWLRLGVLVLALAALTALLINRRLPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLBr01808 |
Synonyms | MLBr01808; UPF0353 protein MLBr01808 |
UniProt ID | B8ZS82 |
◆ Recombinant Proteins | ||
CDH9-3811H | Recombinant Human CDH9 protein, His-tagged | +Inquiry |
BECN1-296H | Recombinant Human BECN1 protein, His/MBP-tagged | +Inquiry |
AGER-0451H | Recombinant Human AGER Protein (Ile91-Asp274), N-His-tagged | +Inquiry |
SAFA-0427B | Recombinant Bacillus subtilis SAFA protein, His-tagged | +Inquiry |
C11orf80-486H | Recombinant Human C11orf80 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf119-8105HCL | Recombinant Human C21orf119 293 Cell Lysate | +Inquiry |
Dorsal-638B | Bovine Dorsal Root Ganglia Lysate, Total Protein | +Inquiry |
RPE-1419MCL | Recombinant Mouse RPE cell lysate | +Inquiry |
SMPD3-1651HCL | Recombinant Human SMPD3 cell lysate | +Inquiry |
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLBr01808 Products
Required fields are marked with *
My Review for All MLBr01808 Products
Required fields are marked with *
0
Inquiry Basket