Recombinant Full Length Mumps Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL18438MF |
Product Overview : | Recombinant Full Length Mumps virus Hemagglutinin-neuraminidase(HN) Protein (P19762) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | MuV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MEPSKLFIMSDNATVAPGPVVNAAGKKTFRTCFRILVLSVQAVTLILVIVTLGELIRMIN DQGLSNQLSSITDKIRESAAVIASAVGVMNQVIHGVTVSLPLQIEGNQNQLLSTLATICT NRNQVSNCSTNIPLVNDLRFINGINKFIIEDYATHDFSIGNPLNMPSFIPTATSPNGCTR IPSFSLGKTHWCYTHNVINANCKDHTSSNQYVSMGILVQTASGYPMFKTLKIQYLSDGLN RKSCSIATVPDGCAMYCYVSTQLEANDYAGSSPPTQKLTLLFYNDTITERTISPSGLEGN WATLVPGVGSGIYFENKLIFPAYGGVLPNSTLGVKSAREFFRPVNPYNPCSGPPQELDQR ALRSYFPRYFSSRRVQSAFLVCAWNQILVTNCELVVPSNNQTLMGAEGRVLLINNRLLYY QRSTSWWPYELLYEISFTFTNSGQSSVNMSWIPIYSFTPPGSGNCSGKNVCPTVCVSGVY LDPWPLTPYSHQSGINRNFYFTGALLNSSTTRVNPTLYVSALNNLKVLAPYGTQGLFASY TTTTCFQDTGDASVYCVYIMELASNIVGEFQILPVLARLTIT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P19762 |
◆ Recombinant Proteins | ||
IGSF21A-8304Z | Recombinant Zebrafish IGSF21A | +Inquiry |
TADA3-4604R | Recombinant Rhesus monkey TADA3 Protein, His-tagged | +Inquiry |
HSPA14-1985R | Recombinant Rhesus Macaque HSPA14 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL31732SF | Recombinant Full Length Schizosaccharomyces Pombe Protein Transport Protein Sft2(Sft2) Protein, His-Tagged | +Inquiry |
Tnfrsf14-869M | Active Recombinant Mouse Tnfrsf14 Protein, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
TF-262H | Native Human Transferrin | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAPTM5-375HCL | Recombinant Human LAPTM5 lysate | +Inquiry |
FOXC1-6161HCL | Recombinant Human FOXC1 293 Cell Lysate | +Inquiry |
DDR2-2172MCL | Recombinant Mouse DDR2 cell lysate | +Inquiry |
NDUFS5-3894HCL | Recombinant Human NDUFS5 293 Cell Lysate | +Inquiry |
BET1-8465HCL | Recombinant Human BET1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket