Recombinant Full Length Mouse Tripartite Motif-Containing Protein 59(Trim59) Protein, His-Tagged
Cat.No. : | RFL4481MF |
Product Overview : | Recombinant Full Length Mouse Tripartite motif-containing protein 59(Trim59) Protein (Q922Y2) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCR SIIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCLLDKKLVCGHC LTIGQHHGHPIDDLQSAYLKEKDTPQKLLKQLTDTHWTDITRLIEKLEEQKCHSEKIVQG DKEVVLQYFKELIDTLEQKKKYFLAALCDVGKMINQEYTPQIQGMKEIREQQLELMTITT SLQDESPLKFLEKIDEVRQRVQMLKQRPLPEVQPVEIYPRVSNVLKEEWSRIEIGRIKKA VIPEMRVSSKRTPCSWSDNDEKEMELFKILNIAIVSLISVILMLILLFNHHIITFLNEIT SICFSEVFLSVYQSLSKNLYDLNNTVCYTLYLLKEFMWKIVSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Trim59 |
Synonyms | Trim59; Mrf1; Tripartite motif-containing protein 59; RING finger protein 1 |
UniProt ID | Q922Y2 |
◆ Recombinant Proteins | ||
CTHRC1-1315R | Recombinant Rat CTHRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NXT2-3146R | Recombinant Rhesus monkey NXT2 Protein, His-tagged | +Inquiry |
DKK1-27614TH | Recombinant Human DKK1 | +Inquiry |
RFL3307VF | Recombinant Full Length Vaccinia Virus Cell Surface-Binding Protein (Mva105L, Acam3000_Mva_105) Protein, His-Tagged | +Inquiry |
RRP36-3479HF | Recombinant Full Length Human RRP36 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TSH-10B | Active Native Bovine TSH Protein | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
CKB-8079H | Active Native Human CKB protein | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFE2L2-3854HCL | Recombinant Human NFE2L2 293 Cell Lysate | +Inquiry |
WNT8A-287HCL | Recombinant Human WNT8A 293 Cell Lysate | +Inquiry |
FAM162A-6416HCL | Recombinant Human FAM162A 293 Cell Lysate | +Inquiry |
HA-2604HCL | Recombinant H3N2 HA cell lysate | +Inquiry |
LGR6-4757HCL | Recombinant Human LGR6 293 Cell Lysate, transcript variant 2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Trim59 Products
Required fields are marked with *
My Review for All Trim59 Products
Required fields are marked with *
0
Inquiry Basket