Recombinant Full Length Chicken Tripartite Motif-Containing Protein 59(Trim59) Protein, His-Tagged
Cat.No. : | RFL29040GF |
Product Overview : | Recombinant Full Length Chicken Tripartite motif-containing protein 59(TRIM59) Protein (Q5ZMD4) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MHQFEEELTCSICYSLFEDPRVLPCSHTFCRSCLEGVIQLSSNFSIWRPLRVPLKCPNCR SIVEIPASGTESLPINFALKAIIEKYRQEDHSDVATCSEHYRQPLNVYCLLDKKLVCGHC LTIGKHNGHPIDDLHSAYLKEKESSGKILEQLTDKHWSDVCLLIEKLKEQKAQCESIVQD DKKVVVQYFKKLSETLEHKKQVLLAALDEINRQILEEYEPHIEKLKKIREEQLELMSLNT SIQKEESPLVFLEKVDNVHQRIKALKEKELPDVKPVEVYPRVGHLLKDVWSKTEIGQINK ILTPKIKLVPKRKLHSKNSEKERGKPEELLQAANPLSVTFIFTVIIAIAVLSFHKPISSV VIESIPTHISDFFGFLYQDFCTCMQNTVDVVCHKLNSLAEFLGGIVPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRIM59 |
Synonyms | TRIM59; RCJMB04_2h17; Tripartite motif-containing protein 59 |
UniProt ID | Q5ZMD4 |
◆ Recombinant Proteins | ||
NUAK1-1067 | Recombinant Human NUAK1 protein, GST-tagged | +Inquiry |
SDR42E1-3584Z | Recombinant Zebrafish SDR42E1 | +Inquiry |
FXR2-13053H | Recombinant Human FXR2, His-tagged | +Inquiry |
TRPM5-6813Z | Recombinant Zebrafish TRPM5 | +Inquiry |
HACL1-7467M | Recombinant Mouse HACL1 Protein | +Inquiry |
◆ Native Proteins | ||
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY2-7268HCL | Recombinant Human CRY2 293 Cell Lysate | +Inquiry |
COG7-7382HCL | Recombinant Human COG7 293 Cell Lysate | +Inquiry |
U937-182H | U937 Whole Cell Lysate | +Inquiry |
MSI2-4115HCL | Recombinant Human MSI2 293 Cell Lysate | +Inquiry |
HA-1818ICL | Recombinant Influenza B HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM59 Products
Required fields are marked with *
My Review for All TRIM59 Products
Required fields are marked with *
0
Inquiry Basket