Recombinant Human TRIM59 protein, GST-tagged

Cat.No. : TRIM59-301346H
Product Overview : Recombinant Human TRIM59 (128-326 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gly128-Phe326
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TRIM59 tripartite motif containing 59 [ Homo sapiens ]
Official Symbol TRIM59
Synonyms TRIM59; tripartite motif containing 59; TRIM57, tripartite motif containing 57 , tripartite motif containing 59; tripartite motif-containing protein 59; Mrf1; RNF104; TSBF1; tumor suppressor TSBF1; RING finger protein 104; tumor suppressor TSBF-1; tripartite motif-containing 57; tripartite motif-containing 59; MRF1; TRIM57; MGC26631; MGC129860; MGC129861;
Gene ID 286827
mRNA Refseq NM_173084
Protein Refseq NP_775107
UniProt ID Q8IWR1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRIM59 Products

Required fields are marked with *

My Review for All TRIM59 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon