Recombinant Human TRIM59 protein, His-tagged

• Cat.No.: TRIM59-3115H
• Product Overview: Recombinant Human TRIM59 protein(128-326 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 128-326 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRIM59 tripartite motif containing 59 [ Homo sapiens ]
• Official Symbol: TRIM59
• Synonyms: TRIM59; tripartite motif containing 59; TRIM57, tripartite motif containing 57 , tripartite motif containing 59; tripartite motif-containing protein 59; Mrf1; RNF104; TSBF1; tumor suppressor TSBF1; RING finger protein 104; tumor suppressor TSBF-1; tripartite motif-containing 57; tripartite motif-containing 59; MRF1; TRIM57; MGC26631; MGC129860; MGC129861
• Gene ID: 286827
• mRNA Refseq: NM_173084
• Protein Refseq: NP_775107
• UniProt ID: Q8IWR1