Recombinant Full Length Mouse Substance-K Receptor(Tacr2) Protein, His-Tagged
Cat.No. : | RFL4631MF |
Product Overview : | Recombinant Full Length Mouse Substance-K receptor(Tacr2) Protein (P30549) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGSTFCYFQNLFPVTAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLFMT GDMTHSEATNGQVGGPQDGEPAGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tacr2 |
Synonyms | Tacr2; Tac2r; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2 |
UniProt ID | P30549 |
◆ Recombinant Proteins | ||
PBXIP1-1544H | Recombinant Human PBXIP1, GST-tagged | +Inquiry |
UNC5A-17847M | Recombinant Mouse UNC5A Protein | +Inquiry |
FAM3D-3663H | Recombinant Human FAM3D Protein (Tyr26-Phe224), C-His tagged | +Inquiry |
CA10-422R | Recombinant Rhesus Macaque CA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADIPOQ-4360H | Recombinant Human ADIPOQ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
CD40LG-001CCL | Recombinant Canine CD40LG cell lysate | +Inquiry |
HeLa-003HCL | Human HeLa Whole Cell Lysate | +Inquiry |
FCGR2-1986MCL | Recombinant Mouse FCGR2 cell lysate | +Inquiry |
POU4F3-3001HCL | Recombinant Human POU4F3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tacr2 Products
Required fields are marked with *
My Review for All Tacr2 Products
Required fields are marked with *
0
Inquiry Basket