Recombinant Full Length Bovine Substance-K Receptor(Tacr2) Protein, His-Tagged
Cat.No. : | RFL9652BF |
Product Overview : | Recombinant Full Length Bovine Substance-K receptor(TACR2) Protein (P05363) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MGACVVMTDINISSGLDSNATGITAFSMPGWQLALWTAAYLALVLVAVMGNATVIWIILA HQRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPGTRAVIAGIWLVALALAFPQCFYSTITTDEGATK CVVAWPEDSGGKMLLLYHLIVIALIYFLPLVVMFVAYSVIGLTLWRRSVPGHQAHGANLR HLQAKKKFVKTMVLVVVTFAICWLPYHLYFILGTFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKMELTYTPSLSTRVNRCHTKEIFFMS GDVAPSEAVNGQAESPQAGVSTEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TACR2 |
Synonyms | TACR2; TAC2R; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2 |
UniProt ID | P05363 |
◆ Recombinant Proteins | ||
CDC27-3589H | Recombinant Human CDC27 protein, His-tagged | +Inquiry |
PATL1-3549H | Recombinant Human PATL1 protein, His-tagged | +Inquiry |
SDF2L1-3926R | Recombinant Rhesus Macaque SDF2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASH1L-2031M | Recombinant Mouse ASH1L Protein | +Inquiry |
MZT2-10370M | Recombinant Mouse MZT2 Protein | +Inquiry |
◆ Native Proteins | ||
ACPP-29981TH | Native Human ACPP | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLL4-2495MCL | Recombinant Mouse DLL4 cell lysate | +Inquiry |
TM4SF4-1034HCL | Recombinant Human TM4SF4 293 Cell Lysate | +Inquiry |
RBBP7-2489HCL | Recombinant Human RBBP7 293 Cell Lysate | +Inquiry |
MB21D1-7994HCL | Recombinant Human C6orf150 293 Cell Lysate | +Inquiry |
ARSA-3086HCL | Recombinant Human ARSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TACR2 Products
Required fields are marked with *
My Review for All TACR2 Products
Required fields are marked with *
0
Inquiry Basket