Recombinant Full Length Rat Substance-K Receptor(Tacr2) Protein, His-Tagged
Cat.No. : | RFL16149RF |
Product Overview : | Recombinant Full Length Rat Substance-K receptor(Tacr2) Protein (P16610) (1-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-390) |
Form : | Lyophilized powder |
AA Sequence : | MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT GDMTHSEATNGQVGSPQDGEPAGPICKAQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tacr2 |
Synonyms | Tacr2; Tac2r; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2 |
UniProt ID | P16610 |
◆ Recombinant Proteins | ||
PLB1-4156R | Recombinant Rat PLB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCGR-5413H | Recombinant Human GCGR protein, His-tagged | +Inquiry |
ZNF354A-6350R | Recombinant Rat ZNF354A Protein, His (Fc)-Avi-tagged | +Inquiry |
LAPTM4A-2767C | Recombinant Chicken LAPTM4A | +Inquiry |
lpxC-4295A | Recombinant Acinetobacter baumannii lpxC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Neuraminidase-009C | Active Native Clostridium perfringens Neuraminidase, Type VIII | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD4-947CCL | Recombinant Cynomolgus CD4 cell lysate | +Inquiry |
GP6-5821HCL | Recombinant Human GP6 293 Cell Lysate | +Inquiry |
CEACAM6-2797HCL | Recombinant Human CEACAM6 cell lysate | +Inquiry |
TCEB3-1751HCL | Recombinant Human TCEB3 cell lysate | +Inquiry |
MAPRE3-4479HCL | Recombinant Human MAPRE3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tacr2 Products
Required fields are marked with *
My Review for All Tacr2 Products
Required fields are marked with *
0
Inquiry Basket