Recombinant Full Length Guinea Pig Substance-K Receptor(Tacr2) Protein, His-Tagged
Cat.No. : | RFL7357CF |
Product Overview : | Recombinant Full Length Guinea pig Substance-K receptor(TACR2) Protein (Q64077) (1-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-402) |
Form : | Lyophilized powder |
AA Sequence : | MGACVIVTNTNISSGLESNTTGITAFSMPTWQLALWATAYLALVLVAVTGNATVTWIILA HQRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAIDRYMAIVHPFQPRLSAPSTKAVIGGIWLVALALAFPQCFYSTITEDEGATK CVVAWPEDSRDKSLLLYHLVVIVLIYLLPLTVMFVAYSIIGLTLWRRAVPRHQAHGANLR HLQAKKKFVKTMVLVVVTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNRRFRSGFRLAFRCCPWVTPTEEDKLELTHTPSFSLRVNRCHTKEILFMA GDTVPSEATNGQAGGPQDRESVELSSLPGCRAGPSILAKASS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TACR2 |
Synonyms | TACR2; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2 |
UniProt ID | Q64077 |
◆ Recombinant Proteins | ||
CHRNA10A-3941Z | Recombinant Zebrafish CHRNA10A | +Inquiry |
ATG10-2073M | Recombinant Mouse ATG10 Protein | +Inquiry |
TTC23L-710H | Recombinant Human TTC23L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HCAR2-1050H | Recombinant Human HCAR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7758CF | Recombinant Full Length Candida Glabrata Cytochrome C Oxidase Subunit 3(Cox3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CKMB-165H | Active Native Human Creatine Kinase MB | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
DOCK2-503HCL | Recombinant Human DOCK2 cell lysate | +Inquiry |
REG1A-1364RCL | Recombinant Rat REG1A cell lysate | +Inquiry |
DPPA5-6824HCL | Recombinant Human DPPA5 293 Cell Lysate | +Inquiry |
TBC1D26-1224HCL | Recombinant Human TBC1D26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TACR2 Products
Required fields are marked with *
My Review for All TACR2 Products
Required fields are marked with *
0
Inquiry Basket