Recombinant Full Length Mouse Protein Tweety Homolog 3(Ttyh3) Protein, His-Tagged
Cat.No. : | RFL1243MF |
Product Overview : | Recombinant Full Length Mouse Protein tweety homolog 3(Ttyh3) Protein (Q6P5F7) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MAGVSYAAPWWVSLLHRLPHFDLRWEATSSQFRPEDADYQQALLLLGATALACLALDLLF LLFYSFWLCCRRRKTDEHLDADCCCTAWCVIITTLVCSAGIAVGFYGNGETSDGIHRATY SLRHANRTVAGVQDRVWDTAAALNRTAEPNLQSLERQLAGRQEPLRAVQRLQTLLGTLLG YTAAIPFWRNPGVSLEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILV GVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDTFVTKMVEEHSVLSGDILQYYLACS PRATNPFQQKLSGSHKALVEMQDVVAELLRNVPREHPATKDPLLRVQEVLNGTEVNLQHL TALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSIPHTWQQKRGPD DDGEEETAPGPRQAHDSLYRVHMPSLYSCGSSYGSEASIPAAAHTVSNAPVTEYMSQNAN FQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRPDSSGSGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ttyh3 |
Synonyms | Ttyh3; Kiaa1691; Protein tweety homolog 3; mTTY3 |
UniProt ID | Q6P5F7 |
◆ Native Proteins | ||
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMK-5667HCL | Recombinant Human GZMK 293 Cell Lysate | +Inquiry |
CCK-7737HCL | Recombinant Human CCK 293 Cell Lysate | +Inquiry |
BRSK2-8403HCL | Recombinant Human BRSK2 293 Cell Lysate | +Inquiry |
SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
Spinal cord-463H | Human Spinal cord Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ttyh3 Products
Required fields are marked with *
My Review for All Ttyh3 Products
Required fields are marked with *
0
Inquiry Basket