Recombinant Full Length Xenopus Laevis Protein Tweety Homolog 3(Ttyh3) Protein, His-Tagged
Cat.No. : | RFL15857XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein tweety homolog 3(ttyh3) Protein (Q6GPA5) (1-522aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-522) |
Form : | Lyophilized powder |
AA Sequence : | MAAAISYTPPWWVNLLHRLPHLNLQWESLNGDFRPEDPDYQQSLMLLACVALSCLALDLL FLLFYSFWFCCRHRKTEENTNADCCCTVWCVIVATLVCSAGIAVGFYGNGETSDGIHRVT YSIRHVNRTMAGIHDRVSDTTTSLNQTVEPCLQNLEVMFTKQTDYLRIVQRLQSLLYTLV QQTSEIPFWKNHYLLDEFAAQVDLFDWYRWLGYLGLLLFHVFICLLVLFGLIRNSKGTLI CVCFLGMMALIISWASMGLELAVAVGSSDFCVNPDTFVSKMVEEKSVLRADILNYYLVCN TGSPNPFQQMLSSGHKALVEMQDDVRDLLRSAVKEYPNSKDYLVCIQGVLNSTEINLQHL TALVDCRGLHLDYVQSLTGFCYDGVEGLIYLVLFSFVTALMFSSIVCSVPHTWQQRRANY EEGDEETTTPGTRQTHDNLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNA NFQNPRCENTPLIGRESPPPSYTSSMRAKYLATNRPETDPVH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ttyh3 |
Synonyms | ttyh3; Protein tweety homolog 3 |
UniProt ID | Q6GPA5 |
◆ Native Proteins | ||
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
Lectin-1860W | Active Native Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
C5b6-1537H | Active Native Human C5b,6 Complex Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF19-1992HCL | Recombinant Human ZNF19 cell lysate | +Inquiry |
SGCG-1887HCL | Recombinant Human SGCG 293 Cell Lysate | +Inquiry |
ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
CD207-7680HCL | Recombinant Human CD207 293 Cell Lysate | +Inquiry |
IL18RAP-1353CCL | Recombinant Cynomolgus IL18RAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ttyh3 Products
Required fields are marked with *
My Review for All ttyh3 Products
Required fields are marked with *
0
Inquiry Basket