Recombinant Full Length Human Protein Tweety Homolog 3(Ttyh3) Protein, His-Tagged
Cat.No. : | RFL24537HF |
Product Overview : | Recombinant Full Length Human Protein tweety homolog 3(TTYH3) Protein (Q9C0H2) (1-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-523) |
Form : | Lyophilized powder |
AA Sequence : | MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLF LLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATY SLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLG YTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILV GVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKMVEEYSVLSGDILQYYLACS PRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVLNGTEVNLQHL TALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPD EDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNAN FQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTYH3 |
Synonyms | TTYH3; KIAA1691; Protein tweety homolog 3; hTTY3 |
UniProt ID | Q9C0H2 |
◆ Recombinant Proteins | ||
NIPAL4-6632HF | Recombinant Full Length Human NIPAL4 Protein | +Inquiry |
CDC27-932R | Recombinant Rat CDC27 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAMTOR2-31332TH | Recombinant Human LAMTOR2, His-tagged | +Inquiry |
EPYC-549H | Recombinant Human EPYC | +Inquiry |
CRH-1974M | Recombinant Mouse CRH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
COL5-136H | Native Human Collagen Type IV | +Inquiry |
pepsin -173P | Native Pig pepsin | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
HA-1668HCL | Recombinant H4N4 HA cell lysate | +Inquiry |
INSIG2-5192HCL | Recombinant Human INSIG2 293 Cell Lysate | +Inquiry |
RPL17-2221HCL | Recombinant Human RPL17 293 Cell Lysate | +Inquiry |
VEZF1-413HCL | Recombinant Human VEZF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTYH3 Products
Required fields are marked with *
My Review for All TTYH3 Products
Required fields are marked with *
0
Inquiry Basket