Recombinant Full Length Danio Rerio Protein Tweety Homolog 3(Ttyh3) Protein, His-Tagged
Cat.No. : | RFL33725DF |
Product Overview : | Recombinant Full Length Danio rerio Protein tweety homolog 3(ttyh3) Protein (Q32LT7) (1-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-560) |
Form : | Lyophilized powder |
AA Sequence : | MAAVVNYSPPWWVNLFHRLPHFNLQFQQTSSDFRPDDSDYQKAVLLLGAAALVCLALDLL FLLFYSFWLCCCRRKNHDSPNADCCCTAWCVIIATLVCSAGIAVGFYGNGETCDGVTRLT YSLRHANQTVAGIDKLVSESTSSLNETLMEGLVQLETVYSKQTDYLSIVQKLQGQLDELI NLMLGVPFWSSNDLSLDHLASITEQYDWYRWLGYLGLLLFDVIICLLVLVGLIRNSRSIL IGVCFLGVLTLVISWASLGLEFSFAVGASDFCVSPDSYITKVTRENAVINQDILQYYLKC SMGQTNPFQQKLSGSHKALVEMQDDVSELLRSAIRDFPKTKSNLEEMQGVLNSTEVSLHH LTALVDCRSLHMDYVQALTGLCYDGVEGLIYLVLFSFVTALMFSSIVCSVPHTWQSKRSE EEDGDETSATLGSRAPHDNLYRVHMPSLYSCGSSTYGNEASLPAAAHTVSNAPVTEYMSQ NANFQTPRCENTPLIGRESPPPSYTSSMRAKYLATSRPDQPRPTESQNGLEPNMRPDLTS RSAPNSRPNSAIHRPHSAIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ttyh3 |
Synonyms | ttyh3; zgc:123242; Protein tweety homolog 3 |
UniProt ID | Q32LT7 |
◆ Recombinant Proteins | ||
S-064S | Recombinant SARS-CoV-2 Spike RBD (A520S) Mutant Protein, His-tagged | +Inquiry |
LRBA-791H | Recombinant Human LRBA | +Inquiry |
TKFC-1113H | Recombinant Human TKFC Protein, MYC/DDK-tagged | +Inquiry |
NPFFR2-1341H | Recombinant Human NPFFR2, His-tagged | +Inquiry |
CDH7-0994H | Recombinant Human CDH7 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK3-4494HCL | Recombinant Human MAPK3 293 Cell Lysate | +Inquiry |
RECQL4-1491HCL | Recombinant Human RECQL4 cell lysate | +Inquiry |
RAMP2-2536HCL | Recombinant Human RAMP2 293 Cell Lysate | +Inquiry |
TNFAIP8L1-696HCL | Recombinant Human TNFAIP8L1 lysate | +Inquiry |
BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ttyh3 Products
Required fields are marked with *
My Review for All ttyh3 Products
Required fields are marked with *
0
Inquiry Basket