Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged
Cat.No. : | RFL7913MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 135(Gpr135) Protein (Q7TQP2) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MEEQARPPGRPAASATLQGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSR GPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLL TALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPP RDKLGRRRALQLLAGAWLAALGFSLPWDLLRAPREPPAPQSFHRCLYRTSPDPAQLGVAY SVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMI IFVMCCWGPYCFLVLLAATRQGQATQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISML LGRNREEGYRTRNMDAFLPSQGLGFQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEV VMWARKNPVVLFFREGPPDSVMEVGKLHNSETRDSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr135 |
Synonyms | Gpr135; G-protein coupled receptor 135 |
UniProt ID | Q7TQP2 |
◆ Recombinant Proteins | ||
SLC44A4-10724Z | Recombinant Zebrafish SLC44A4 | +Inquiry |
SAP028A-046-4135S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) SAP028A_046 protein, His-tagged | +Inquiry |
ARL13B-1923M | Recombinant Mouse ARL13B Protein | +Inquiry |
IKZF1-182H | Recombinant Human IKZF1 protein, T7/His-tagged | +Inquiry |
LAYN-2350R | Recombinant Rat LAYN protein(Met1-Glu224), hFc-tagged | +Inquiry |
◆ Native Proteins | ||
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
LDL-12H | Native Human LDL Protein | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RAPL1-2740HCL | Recombinant Human IL1RAPL1 Overexpression Lysate | +Inquiry |
ZNF280A-103HCL | Recombinant Human ZNF280A 293 Cell Lysate | +Inquiry |
ATG4C-8623HCL | Recombinant Human ATG4C 293 Cell Lysate | +Inquiry |
GMPS-5873HCL | Recombinant Human GMPS 293 Cell Lysate | +Inquiry |
PACRG-3474HCL | Recombinant Human PACRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr135 Products
Required fields are marked with *
My Review for All Gpr135 Products
Required fields are marked with *
0
Inquiry Basket