Recombinant Full Length Human Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged
Cat.No. : | RFL29517HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 135(GPR135) Protein (Q8IZ08) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MEEPQPPRPPASMALLGSQHSGAPSAAGPPGGTSSAATAAVLSFSTVATAALGNLSDASG GGTAAAPGGGGLGGSGAAREAGAAVRRPLGPEAAPLLSHGAAVAAQALVLLLIFLLSSLG NCAVMGVIVKHRQLRTVTNAFILSLSLSDLLTALLCLPAAFLDLFTPPGGSAPAAAAGPW RGFCAASRFFSSCFGIVSTLSVALISLDRYCAIVRPPREKIGRRRALQLLAGAWLTALGF SLPWELLGAPRELAAAQSFHGCLYRTSPDPAQLGAAFSVGLVVACYLLPFLLMCFCHYHI CKTVRLSDVRVRPVNTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFLVLLAAARQAQ TMQAPSLLSVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQGP GLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTA VTKQPKSEAGDTSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR135 |
Synonyms | GPR135; G-protein coupled receptor 135 |
UniProt ID | Q8IZ08 |
◆ Recombinant Proteins | ||
GOLGA6A-983H | Recombinant Human GOLGA6A | +Inquiry |
KLK5-26H | Recombinant Human KLK5 protein, His-tagged | +Inquiry |
POU3F2-4584R | Recombinant Rat POU3F2 Protein | +Inquiry |
SCYL1-5282R | Recombinant Rat SCYL1 Protein | +Inquiry |
GLUL-18H | Active Recombinant Human GLUL protein, His-tagged (Bioactivity Validated) | +Inquiry |
◆ Native Proteins | ||
Prothrombin-93H | Native Human Prothrombin | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
Lectin-1726W | Native Wheat Germ Lectin, FITC conjugated | +Inquiry |
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAX1BP3-1235HCL | Recombinant Human TAX1BP3 293 Cell Lysate | +Inquiry |
PREP-001MCL | Recombinant Mouse PREP cell lysate | +Inquiry |
TOP3B-1810HCL | Recombinant Human TOP3B cell lysate | +Inquiry |
CKLF-7485HCL | Recombinant Human CKLF 293 Cell Lysate | +Inquiry |
LYAR-1040HCL | Recombinant Human LYAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GPR135 Products
Required fields are marked with *
My Review for All GPR135 Products
Required fields are marked with *
0
Inquiry Basket