Recombinant Human GPR135 Protein, GST-tagged

• Cat.No.: GPR135-5183H
• Product Overview: Human GPR135 partial ORF ( NP_072093, 391 a.a. - 493 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GPR135 (G Protein-Coupled Receptor 135) is a Protein Coding gene. Among its related pathways are GPCRs, Other. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is GPR45.
• Molecular Mass: 37.07 kDa
• AA Sequence: NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR135 G protein-coupled receptor 135 [ Homo sapiens (human) ]
• Official Symbol: GPR135
• Synonyms: GPR135; G protein-coupled receptor 135; HUMNPIIY20; probable G-protein coupled receptor 135
• Gene ID: 64582
• mRNA Refseq: NM_022571
• Protein Refseq: NP_072093
• MIM: 607970
• UniProt ID: Q8IZ08