Recombinant Full Length Rat Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged
Cat.No. : | RFL5945RF |
Product Overview : | Recombinant Full Length Rat Probable G-protein coupled receptor 135(Gpr135) Protein (Q7TQN7) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MEEQARPPSRPAASATLPGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSR GPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLL TALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPP RDKLGRRRALQLLAGAWLAALGFSLPWELLRAPREPPTPQSFHRCLYRTSPDPAQLGAAY SVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMI VFVICCWGPYCFLVLLAATRQGQTTQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISMF LGRNREEGYRTRNMDVFLPSQGLGFQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEV VMWARKNPVVLFFREDPPDPVMAVYKQHKSETRDSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr135 |
Synonyms | Gpr135; G-protein coupled receptor 135 |
UniProt ID | Q7TQN7 |
◆ Native Proteins | ||
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYGO2-1451HCL | Recombinant Human PYGO2 cell lysate | +Inquiry |
DALRD3-7081HCL | Recombinant Human DALRD3 293 Cell Lysate | +Inquiry |
CNN1-7406HCL | Recombinant Human CNN1 293 Cell Lysate | +Inquiry |
SLC22A9-1789HCL | Recombinant Human SLC22A9 293 Cell Lysate | +Inquiry |
ZNF501-62HCL | Recombinant Human ZNF501 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr135 Products
Required fields are marked with *
My Review for All Gpr135 Products
Required fields are marked with *
0
Inquiry Basket