Recombinant Full Length Mouse Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase(St3Gal3) Protein, His-Tagged

• Cat.No.: RFL509MF
• Product Overview: Recombinant Full Length Mouse CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase(St3gal3) Protein (P97325) (1-374aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mus musculus
• Source: E.coli
• Tag: His
• Protein Length: Full Length (1-374)
• Form: Lyophilized powder
• AA Sequence: MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLLLSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: St3gal3
• Synonyms: St3gal3; Siat3; Siat6; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; Beta-galactoside alpha-2,3-sialyltransferase 3; Alpha 2,3-ST 3; Gal beta-1,3(4 GlcNAc alpha-2,3 sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltrans
• UniProt ID: P97325