Recombinant Full Length Mouse Ceramide Synthase 5(Cers5) Protein, His-Tagged
Cat.No. : | RFL16061MF |
Product Overview : | Recombinant Full Length Mouse Ceramide synthase 5(Cers5) Protein (Q9D6K9) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MATAAAETLGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSV RMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPY QPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVG ALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFES WEIIGPYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVSKDDRSDVESSSEEED ETTHKNNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFRASPHLHSCD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cers5 |
Synonyms | Cers5; Lass5; Trh4; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5; Translocating chain-associating membrane protein homolog 4; TRAM homolog 4 |
UniProt ID | Q9D6K9 |
◆ Native Proteins | ||
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
FG-116H | Native Human Fibrinogen | +Inquiry |
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDHD-2008HCL | Recombinant Human SDHD 293 Cell Lysate | +Inquiry |
Colon descending-6H | Human Adult Colon descending Membrane Lysate | +Inquiry |
WISP1-308HCL | Recombinant Human WISP1 293 Cell Lysate | +Inquiry |
PAF1-466HCL | Recombinant Human PAF1 lysate | +Inquiry |
CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cers5 Products
Required fields are marked with *
My Review for All Cers5 Products
Required fields are marked with *
0
Inquiry Basket