Recombinant Full Length Human Ceramide Synthase 5(Cers5) Protein, His-Tagged
Cat.No. : | RFL7254HF |
Product Overview : | Recombinant Full Length Human Ceramide synthase 5(CERS5) Protein (Q8N5B7) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CERS5 |
Synonyms | CERS5; LASS5; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5 |
UniProt ID | Q8N5B7 |
◆ Recombinant Proteins | ||
ITIH1-2828H | Recombinant Human ITIH1 Protein (Gly506-Leu818), N-His tagged | +Inquiry |
PADI6-1507H | Recombinant Human PADI6, GST-tagged | +Inquiry |
GEMIN8-5583H | Recombinant Human GEMIN8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD276-183HP | Recombinant Human CD276 protein, Fc-tagged, R-PE labeled | +Inquiry |
GTF3C4-1834R | Recombinant Rhesus Macaque GTF3C4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCM6-4416HCL | Recombinant Human MCM6 293 Cell Lysate | +Inquiry |
MRE11A-4211HCL | Recombinant Human MRE11A 293 Cell Lysate | +Inquiry |
PPP2R2A-2924HCL | Recombinant Human PPP2R2A 293 Cell Lysate | +Inquiry |
BCL2L13-61HCL | Recombinant Human BCL2L13 lysate | +Inquiry |
RILPL1-649HCL | Recombinant Human RILPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERS5 Products
Required fields are marked with *
My Review for All CERS5 Products
Required fields are marked with *
0
Inquiry Basket