Recombinant Full Length Mitochondrial Inner Membrane Organizing System Protein F54A3.5(F54A3.5) Protein, His-Tagged
Cat.No. : | RFL30761CF |
Product Overview : | Recombinant Full Length Mitochondrial inner membrane organizing system protein F54A3.5(F54A3.5) Protein (Q9N4K0) (1-105aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-105) |
Form : | Lyophilized powder |
AA Sequence : | MAPGASAPAASRSEDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGV GLGTGWSNCRHDFASPYVLHGKRVPAGQDSQGKPAYNIITEQHKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F54A3.5 |
Synonyms | F54A3.5; MICOS complex subunit Mic10 |
UniProt ID | Q9N4K0 |
◆ Recombinant Proteins | ||
NPDC1-1271H | Recombinant Human NPDC1 Protein, MYC/DDK-tagged | +Inquiry |
ARMETL1-301309H | Recombinant Human ARMETL1 protein, GST-tagged | +Inquiry |
AL529-RS11665-1254S | Recombinant Staphylococcus capitis (strain: FDAARGOS_173, nat-host: Homo sapiens, culture-collection: FDA:FDAARGOS_173) AL529_RS11665 protein, His-tagged | +Inquiry |
Gale-3136M | Recombinant Mouse Gale Protein, Myc/DDK-tagged | +Inquiry |
SLC35C1-4091R | Recombinant Rhesus Macaque SLC35C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL6-2190HCL | Recombinant Human RPL6 293 Cell Lysate | +Inquiry |
CYP2E1-7111HCL | Recombinant Human CYP2E1 293 Cell Lysate | +Inquiry |
LIPE-4725HCL | Recombinant Human LIPE 293 Cell Lysate | +Inquiry |
AP3B1-8810HCL | Recombinant Human AP3B1 293 Cell Lysate | +Inquiry |
MST1R-1962HCL | Recombinant Human MST1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F54A3.5 Products
Required fields are marked with *
My Review for All F54A3.5 Products
Required fields are marked with *
0
Inquiry Basket