Recombinant Full Length Miniconductance Mechanosensitive Channel(Mscm) Protein, His-Tagged
Cat.No. : | RFL7918SF |
Product Overview : | Recombinant Full Length Miniconductance mechanosensitive channel(mscM) Protein (P0AAT5) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVLRTFEKRAIASSRLWL QIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQLWIMMYALLSVFSLLD VILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQSPAILISGLGAMAAVLM LVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIP TWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDEMQRLNKAHLLKPYLTSRHQ EINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLAPGDNGLP LEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQSPTGNDIRSLAGAFKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybdG |
Synonyms | ybdG; SF0483; S0492; Miniconductance mechanosensitive channel YbdG |
UniProt ID | P0AAT5 |
◆ Recombinant Proteins | ||
KRTAP5-1-8898M | Recombinant Mouse KRTAP5-1 Protein | +Inquiry |
ORMDL2-1375H | Recombinant Human ORMDL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFX3-1886H | Recombinant Human RFX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCG2-1217H | Recombinant Human SCG2 Protein, His-tagged | +Inquiry |
PTPLAD2-3518R | Recombinant Rhesus Macaque PTPLAD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
S-52H | Native Human Protein S | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSPH-1430HCL | Recombinant Human PSPH cell lysate | +Inquiry |
Adipose-503D | Dog Adipose Tissue Lysate, Total Protein | +Inquiry |
ZNF414-2022HCL | Recombinant Human ZNF414 cell lysate | +Inquiry |
CTBP1-7215HCL | Recombinant Human CTBP1 293 Cell Lysate | +Inquiry |
RNF126-2303HCL | Recombinant Human RNF126 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybdG Products
Required fields are marked with *
My Review for All ybdG Products
Required fields are marked with *
0
Inquiry Basket