Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Ybdg(Ybdg) Protein, His-Tagged
Cat.No. : | RFL23119BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein ybdG(ybdG) Protein (O31431) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKGTVVDVDGKKMNVYQE GSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYGYSEVSHDDRDIDTVLE QTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIAMDIGLPQQYVTYKLSGV DRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEIYKAINFKQFFNADMEHEL LQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNRKDYEAFAAQFNTADIKELR GTHSIYLYQPDQIYKLSMEFMRKVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybdG |
Synonyms | ybdG; ybdH; BSU01990; Uncharacterized protein YbdG |
UniProt ID | O31431 |
◆ Recombinant Proteins | ||
ARMC1-825H | Recombinant Human ARMC1 protein, GST-tagged | +Inquiry |
NPTN-6048H | Recombinant Human NPTN Protein | +Inquiry |
SPATA31E1-4126H | Recombinant Human SPATA31E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC3C-1574H | Recombinant Human APOBEC3C protein | +Inquiry |
ABHD13-16R | Recombinant Rhesus Macaque ABHD13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-30880TH | Native Human PLG | +Inquiry |
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCS1L-167HCL | Recombinant Human BCS1L cell lysate | +Inquiry |
KIT-463HCL | Recombinant Human KIT cell lysate | +Inquiry |
CEP57L1-124HCL | Recombinant Human CEP57L1 lysate | +Inquiry |
PLK1-532MCL | Recombinant Mouse PLK1 cell lysate | +Inquiry |
EDA2R-990CCL | Recombinant Cynomolgus EDA2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybdG Products
Required fields are marked with *
My Review for All ybdG Products
Required fields are marked with *
0
Inquiry Basket